Home Research Services Publications People Teaching Job Opening News Lab Only
Online Services

I-TASSER QUARK LOMETS COACH COFACTOR MUSTER SEGMER FG-MD ModRefiner REMO SPRING COTH BSpred SVMSEQ ANGLOR BSP-SLIM SAXSTER ThreaDom EvoDesign GPCR-I-TASSER BindProf BindProfX ResQ IonCom STRUM

TM-score TM-align MMalign NWalign EDTSurf MVP MVP-Fit SPICKER HAAD PSSpred 3DRobot I-TASSER-MR

BioLiP E. coli GLASS GPCR-HGmod GPCR-RD GPCR-EXP TM-fold DECOYS POTENTIAL RW HPSF CASP7 CASP8 CASP9 CASP10 CASP11 CASP12

            [Home]   [Forum]   [Example]   [Help]


Sequnce Information of T77(your_protein)

MSNAFEYLRTYVESTTETDAAVARAREDAAEFGLPAPDEMTGQLLTTLAATTNGNGSTGAIAITPAAGLVGLYILNGLAD
NTTLTCIDPESEHQRQAKALFREAGYSPSRVRFLLSRPLDVMSRLANDSYQLVFGQVSPMDLKALVDAAWPLLRRGGALV
LADALLDGTIADQTRKDRDTQAARDADEYIRSIEGAHVARLPLGAGLTVVTKA

The Input Parameters

Unit cell (a,b,c):(50.511,50.511,303.330)
Unit cell (α,β,γ):(90,90,120)
Space Group:P 61 2 2
Copy Number:1
Lowest Resolution:50
Highest Resolution:2.250
mtz file:Download

Best Models with the lowest R-free

MR Model    Refined Model
  
MR-T77-1-M1     R_free=0.4897    Refine-T77-1-M1     R_free=0.4010


I-TASSER-MR Results of Sequence T77
I-TASSER
Models
I-TASSER-MR Models
Model1
Search ModelMR ModelRefined ModelStarting RworkFinal RworkStarting RfreeFinal Rfree
Search-T77-1-M1 MR-T77-1-M1 Refine-T77-1-M1 0.5015 0.3410 0.4897 0.4010
Search-T77-2-M1 MR-T77-2-M1 Refine-T77-2-M1 0.5020 0.3461 0.4939 0.4089
Search-T77-3-M1 MR-T77-3-M1 Refine-T77-3-M1 0.5025 0.3522 0.4932 0.4168
Search-T77-4-M1 MR-T77-4-M1 Refine-T77-4-M1 0.5034 0.3597 0.4927 0.4270
Search-T77-5-M1 MR-T77-5-M1 Refine-T77-5-M1 0.5023 0.3584 0.4973 0.4283
  • I-TASSER Models:the models predicted by I-TASSER;
  • I-TASSER-MR Models: top 5 search models, MR models and refined models ranked by the final Rfreee of the refined models;
  • Search Model: top 5 search models edited by progressive model truncation;
  • MR Model: top 5 models produced by MR-REX from the corresponding top 5 search models;
  • Starting Rwork: the starting Rwork of the refined models;
  • Final Rwork: the final Rwork of the refined models;
  • Starting Rfree: the starting Rfree of the refined models;
  • Final Rfree: the final Rfree of the refined models.

  • I-TASSER Search Models for Sequence T77
    I-TASSER
    Models
    Distribution of the AVS-scoreDownload
    Model1
    cscore:0.98
    Download
  • I-TASSER Models: the models predicted by I-TASSER;
  • Download: the dowload file includes the AVS score file and all the edited search models;

  • Top 10 templates used by I-TASSER for Sequence T77
    RankTemplateAligned LengthCoverageZ-scoreProgramAlignments
    13dr5A2080.97714.816MUSTERDownload
    23dr5_A2070.97216.595HHpred_localDownload
    34pcaa2090.98130.083SP3Download
    43r3hA2090.98112.051PROSPECT2Download
    53r3hA2090.98133.890PPA-IDownload
    65kva_A2090.98125.018HHpred_globalDownload
    74pcaa2090.98131.532SPARKS2Download
    83r3hA2090.98114.608MUSTERDownload
    93cbg_A2080.97716.585HHpred_localDownload
    104qvka2080.97729.967SP3Download
  • Rank of templates: represents the top ten threading templates used by I-TASSER;
  • Aligned length: the number of aligned residues;
  • Coverage: it represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein;
  • Z-score: Z-score is the normalized Z-score of the threading alignments;
  • Download Alignments: Provides the 3D structure of the aligned regions of the threading templates.

  • References:
  • Y. Wang, J. Virtanen, Z. Xue, Y. Zhang. I-TASSER-MR: automated molecular replacement for proteins without close homologs using iterative fragment assembly and progressive sequence truncation, submitted (2017).
  • Y. Wang, J. Virtanen, Z. Xue, J. J. G. Tesmer and Y. Zhang. Using iterative fragment assembly and progressive sequence truncation to facilitate phasing and crystal structure determination of distantly related proteins. Acta Cryst. (2016). D72, 616-628
  • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218