[Zhang Lab Home] [QUARK Server]

QUARK Ab Initio Results for Job Q24927


  Submitted Primary Sequence

>Length 200
DFFYFVQQWPGAYCDTSRGCCNPTSGKPPSDFGIHGLWPNYNSGGYPSNCDSSNPFDPSQIQDLLSQLQTQWPSLTCPSSDGTSFWTHEWNKHGTCSESVLTEHAYFAAALNLKSQANTLASLTNAGITPNNSFYNLSDVLAAIKQGTGHDAYVQCNTDENGNSQLYQIYICVDTTGANFIECPVAPNQNCPSSIEFPSF
12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200

  Predicted Secondary Structure

>C-coil;H-helix;E-sheet;T-beta turn
DFFYFVQQWPGAYCDTSRGCCNPTSGKPPSDFGIHGLWPNYNSGGYPSNCDSSNPFDPSQIQDLLSQLQTQWPSLTCPSSDGTSFWTHEWNKHGTCSESVLTEHAYFAAALNLKSQANTLASLTNAGITPNNSFYNLSDVLAAIKQGTGHDAYVQCNTDENGNSQLYQIYICVDTTGANFIECPVAPNQNCPSSIEFPSF
CEEEEEEECCHHHTTTTTTTCCCCTTTTCCCEEEEEEEETTTTTTTTTTTCCCCCCCHHHHHHHHHHHHHHHHHHHTTTTTTTHHHHHHCTTTTEEECCTTTTHHHHHHHHHHHHHTTTTHHHHHCTTTTCTTTTCHHHHHHHHHHHTTTTCEEEEEETTTTTEEEEEEEEEETTTTTTEEECCCCCCCCCCTTTTECCC
12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
Download Predicted 3-state Secondary Structure Types
Download Predicted Starting Beta-turn Position
Download Predicted Real-value Phi-angle
Download Predicted Real-value Psi-angle
Download Distance Profile from Fragments
Download Clustered Torsion Angle Pairs from Fragments

  Predicted Solvent Accessibility

>0-buried to 9-exposed
DFFYFVQQWPGAYCDTSRGCCNPTSGKPPSDFGIHGLWPNYNSGGYPSNCDSSNPFDPSQIQDLLSQLQTQWPSLTCPSSDGTSFWTHEWNKHGTCSESVLTEHAYFAAALNLKSQANTLASLTNAGITPNNSFYNLSDVLAAIKQGTGHDAYVQCNTDENGNSQLYQIYICVDTTGANFIECPVAPNQNCPSSIEFPSF
10000001100100222411132121322210001000012121211110322321222101100010011001121222312200122023101002211211100000010123020110013121223221110210010014112330201002244232100100000123112002022223331322020044
12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
Download Predicted Solvent Accessibility

  Predicted Tertiary Structure

Download Model 1 Download Model 2 Download Model 3 Download Model 4 Download Model 5
Download Model 6 Download Model 7 Download Model 8 Download Model 9 Download Model 10
Estimated TM-score of Model 1: 0.3611 ±0.0833
Estimated TM-score of the Best of Top 10 Model: 0.4120 ±0.0764
 

Please cite the following article when you use the QUARK server:
 
D. Xu, Y. Zhang, Ab initio protein structure assembly using continuous structure fragments and optimized knowledge-based force field. Proteins, 2012, 80, 1715-1735 (download the PDF file and Support Information).