Hello,
I ran successfully the program I-TASSER before, but suddenly when I am running it now I get the error: "only 0 threading programs have output, please check threading programs". I returned to jobs I ran successfully before, but I still get the error.
Example of an output:
Your setting for running I-TASSER is:
-pkgdir = /usr/local/I-TASSER4.1
-libdir = /usr/local/I-TASSER4.1
-java_home = /usr/
-seqname = Brix1
-datadir = /u/efratk/test/Brix1
-outdir = /u/efratk/test/Brix1
-runstyle = parallel
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = true
-hours = 5
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 353 residues:
> Brix1
MAATKRKRRGGLEVQAKKPKRSSKDAGQPAKQADVAKEAEEENRDRIPGPVCKGKWKNKE
RILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEA
KKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDDLPHYAL
LKEFLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNL
IKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYRERQQVKDVQKLRKKEPKTILPH
DPTADVFVIPAEEKPVEIQWVKPEPKVDLKARKRRIYKRHRKLQQKMSRGSAK
2.1 run Psi-blast
2.2 Predict secondary structure with PSSpred...
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 Use all templates
submit threading jobs first and run pair during threading
3.1 do threading
start parallel threading PPAS
start parallel threading dPPAS
start parallel threading dPPAS2
start parallel threading Env-PPAS
start parallel threading MUSTER
start parallel threading wPPAS
start parallel threading wdPPAS
start parallel threading wMUSTER
running pair now ................
30000 6379375 total lib str & residues
number of observations 14.46104 5405926.
pair done
only 0 threading programs have output, please check threading programs
Can you please help me with that.
Thanks