Below the output when running the "example" sequence through local I-TASSER4.3 (on Ubuntu 14.04):
==============================
Your setting for running I-TASSER is:
-pkgdir = /home/ediths/Software/I-TASSER/I-TASSER4.3
-libdir = /home/ediths/Software/I-TASSER/I-TASSER4.3/libs
-java_home = /usr/
-seqname = example
-datadir = /home/ediths/Software/I-TASSER/I-TASSER4.3/example
-outdir = /home/ediths/Software/I-TASSER/I-TASSER4.3/example
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 143 residues:
> example
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLA
LQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVP
AHKGIGGNEQVDKLVSAGIRKVL
2.1 run Psi-blast
2.2 Predict secondary structure with PSSpred...
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 Use all templates
2.4.2 running pair ................
30000 6379375 total lib str & residues
number of observations 27.03459 1658491.
pair done
3.1 do threading
start serial threading PPAS
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/PPAS_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 15:42:26 CEST 2015
pwd: /tmp/ediths/ITexample
running zalign .....
ending time: Mon Mai 4 15:51:10 CEST 2015
start serial threading dPPAS
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/dPPAS_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 15:51:11 CEST 2015
pwd: /tmp/ediths/ITexample
running zalign .....
ending time: Mon Mai 4 16:09:40 CEST 2015
start serial threading dPPAS2
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/dPPAS2_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 16:09:41 CEST 2015
pwd: /tmp/ediths/ITexample
running zalign .....
ending time: Mon Mai 4 16:27:51 CEST 2015
start serial threading Env-PPAS
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/Env-PPAS_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 16:27:53 CEST 2015
pwd: /tmp/ediths/ITexample
running zalign .....
ending time: Mon Mai 4 16:42:46 CEST 2015
start serial threading MUSTER
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/MUSTER_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 16:42:47 CEST 2015
pwd: /tmp/ediths/ITexample
running Psi-blast .....
running zalign .....
start serial threading wPPAS
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/wPPAS_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 16:45:46 CEST 2015
pwd: /tmp/ediths/ITexample
running Psi-blast .....
ending time: Mon Mai 4 17:15:08 CEST 2015
start serial threading wdPPAS
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/wdPPAS_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 17:15:09 CEST 2015
pwd: /tmp/ediths/ITexample
running Psi-blast .....
ending time: Mon Mai 4 18:02:45 CEST 2015
start serial threading wMUSTER
/tmp/ediths/ITexample
/home/ediths/Software/I-TASSER/I-TASSER4.3/example/wMUSTER_example
hostname: botsun1.uzh.ch
starting time: Mon Mai 4 18:02:46 CEST 2015
pwd: /tmp/ediths/ITexample
running Psi-blast .....
running Psi-blast .....
==>1rilA 1rilA 27.824896775236 18.1717703104015
1rilA 1rilA 26.57 26.57
score_flag=1
ending time: Mon Mai 4 19:01:23 CEST 2015
3.2 make restraints
without init: /home/ediths/Software/I-TASSER/I-TASSER4.3/example/init.MUSTER
type= easy, n_good=35, M0= 7, M1_for_medm=1.4, n_sg= 7 role=SEQ
domain2=no
type=easy----n_temp_use_for_restraints=20
4.1 run simulation
exp.dat: Line-1 is missed !!!!!!
exp.dat: Line-2 is missed !!!!!!
exp.dat: Line-3 is missed !!!!!!
exp.dat: Line-4 is missed !!!!!!
exp.dat: Line-5 is missed !!!!!!
exp.dat: Line-6 is missed !!!!!!
exp.dat: Line-7 is missed !!!!!!
exp.dat: Line-8 is missed !!!!!!
exp.dat: Line-9 is missed !!!!!!
exp.dat: Line-10 is missed !!!!!!
exp.dat: Line-11 is missed !!!!!!
exp.dat: Line-12 is missed !!!!!!
exp.dat: Line-13 is missed !!!!!!
exp.dat: Line-14 is missed !!!!!!
exp.dat: Line-15 is missed !!!!!!
exp.dat: Line-16 is missed !!!!!!
exp.dat: Line-17 is missed !!!!!!
exp.dat: Line-18 is missed !!!!!!
exp.dat: Line-19 is missed !!!!!!
exp.dat: Line-20 is missed !!!!!!
exp.dat: Line-21 is missed !!!!!!
exp.dat: Line-22 is missed !!!!!!
exp.dat: Line-23 is missed !!!!!!
exp.dat: Line-24 is missed !!!!!!
exp.dat: Line-25 is missed !!!!!!
exp.dat: Line-26 is missed !!!!!!
exp.dat: Line-27 is missed !!!!!!
exp.dat: Line-28 is missed !!!!!!
exp.dat: Line-29 is missed !!!!!!
exp.dat: Line-30 is missed !!!!!!
exp.dat: Line-31 is missed !!!!!!
exp.dat: Line-32 is missed !!!!!!
exp.dat: Line-33 is missed !!!!!!
exp.dat: Line-34 is missed !!!!!!
exp.dat: Line-35 is missed !!!!!!
exp.dat: Line-36 is missed !!!!!!
exp.dat: Line-37 is missed !!!!!!
exp.dat: Line-38 is missed !!!!!!
exp.dat: Line-39 is missed !!!!!!
exp.dat: Line-40 is missed !!!!!!
exp.dat: Line-41 is missed !!!!!!
exp.dat: Line-42 is missed !!!!!!
exp.dat: Line-43 is missed !!!!!!
exp.dat: Line-44 is missed !!!!!!
exp.dat: Line-45 is missed !!!!!!
exp.dat: Line-46 is missed !!!!!!
exp.dat: Line-47 is missed !!!!!!
exp.dat: Line-48 is missed !!!!!!
exp.dat: Line-49 is missed !!!!!!
exp.dat: Line-50 is missed !!!!!!
exp.dat: Line-51 is missed !!!!!!
exp.dat: Line-52 is missed !!!!!!
exp.dat: Line-53 is missed !!!!!!
exp.dat: Line-54 is missed !!!!!!
exp.dat: Line-55 is missed !!!!!!
exp.dat: Line-56 is missed !!!!!!
exp.dat: Line-57 is missed !!!!!!
exp.dat: Line-58 is missed !!!!!!
exp.dat: Line-59 is missed !!!!!!
exp.dat: Line-60 is missed !!!!!!
exp.dat: Line-61 is missed !!!!!!
exp.dat: Line-62 is missed !!!!!!
exp.dat: Line-63 is missed !!!!!!
exp.dat: Line-64 is missed !!!!!!
exp.dat: Line-65 is missed !!!!!!
exp.dat: Line-66 is missed !!!!!!
exp.dat: Line-67 is missed !!!!!!
exp.dat: Line-68 is missed !!!!!!
exp.dat: Line-69 is missed !!!!!!
exp.dat: Line-70 is missed !!!!!!
exp.dat: Line-71 is missed !!!!!!
exp.dat: Line-72 is missed !!!!!!
exp.dat: Line-73 is missed !!!!!!
exp.dat: Line-74 is missed !!!!!!
exp.dat: Line-75 is missed !!!!!!
exp.dat: Line-76 is missed !!!!!!
exp.dat: Line-77 is missed !!!!!!
exp.dat: Line-78 is missed !!!!!!
exp.dat: Line-79 is missed !!!!!!
exp.dat: Line-80 is missed !!!!!!
exp.dat: Line-81 is missed !!!!!!
exp.dat: Line-82 is missed !!!!!!
exp.dat: Line-83 is missed !!!!!!
exp.dat: Line-84 is missed !!!!!!
exp.dat: Line-85 is missed !!!!!!
exp.dat: Line-86 is missed !!!!!!
exp.dat: Line-87 is missed !!!!!!
exp.dat: Line-88 is missed !!!!!!
exp.dat: Line-89 is missed !!!!!!
exp.dat: Line-90 is missed !!!!!!
exp.dat: Line-91 is missed !!!!!!
exp.dat: Line-92 is missed !!!!!!
exp.dat: Line-93 is missed !!!!!!
exp.dat: Line-94 is missed !!!!!!
exp.dat: Line-95 is missed !!!!!!
exp.dat: Line-96 is missed !!!!!!
exp.dat: Line-97 is missed !!!!!!
exp.dat: Line-98 is missed !!!!!!
exp.dat: Line-99 is missed !!!!!!
exp.dat: Line-100 is missed !!!!!!
exp.dat: Line-101 is missed !!!!!!
exp.dat: Line-102 is missed !!!!!!
exp.dat: Line-103 is missed !!!!!!
exp.dat: Line-104 is missed !!!!!!
exp.dat: Line-105 is missed !!!!!!
exp.dat: Line-106 is missed !!!!!!
exp.dat: Line-107 is missed !!!!!!
exp.dat: Line-108 is missed !!!!!!
exp.dat: Line-109 is missed !!!!!!
exp.dat: Line-110 is missed !!!!!!
exp.dat: Line-111 is missed !!!!!!
exp.dat: Line-112 is missed !!!!!!
exp.dat: Line-113 is missed !!!!!!
exp.dat: Line-114 is missed !!!!!!
exp.dat: Line-115 is missed !!!!!!
exp.dat: Line-116 is missed !!!!!!
exp.dat: Line-117 is missed !!!!!!
exp.dat: Line-118 is missed !!!!!!
exp.dat: Line-119 is missed !!!!!!
exp.dat: Line-120 is missed !!!!!!
exp.dat: Line-121 is missed !!!!!!
exp.dat: Line-122 is missed !!!!!!
exp.dat: Line-123 is missed !!!!!!
exp.dat: Line-124 is missed !!!!!!
exp.dat: Line-125 is missed !!!!!!
exp.dat: Line-126 is missed !!!!!!
exp.dat: Line-127 is missed !!!!!!
exp.dat: Line-128 is missed !!!!!!
exp.dat: Line-129 is missed !!!!!!
exp.dat: Line-130 is missed !!!!!!
exp.dat: Line-131 is missed !!!!!!
exp.dat: Line-132 is missed !!!!!!
exp.dat: Line-133 is missed !!!!!!
exp.dat: Line-134 is missed !!!!!!
exp.dat: Line-135 is missed !!!!!!
exp.dat: Line-136 is missed !!!!!!
exp.dat: Line-137 is missed !!!!!!
exp.dat: Line-138 is missed !!!!!!
exp.dat: Line-139 is missed !!!!!!
exp.dat: Line-140 is missed !!!!!!
exp.dat: Line-141 is missed !!!!!!
exp.dat: Line-142 is missed !!!!!!
exp.dat: Line-143 is missed !!!!!!
You have 143 errors in your input files. Please fix these problems before you run TASSER
There are problems with your input files
Please check before simulation
=====================================
The exp.dat file contains:
0.05 0.10 0.15 0.20 0.25 0.30 0.35 0.40 0.45 0.50 0.55 0.60 0.65 0.70 0.75 0.80 0.85
=====================================
Thanks for your help!