Home Research Services Publications People Teaching Jobs Opening Facilities News Forum Lab Only
Online Services

I-TASSER QUARK LOMETS COACH COFACTOR MetaGO MUSTER SEGMER FG-MD ModRefiner REMO SPRING COTH BSpred SVMSEQ ANGLOR BSP-SLIM SAXSTER ThreaDom ThreaDomEx EvoDesign GPCR-I-TASSER BindProf BindProfX ResQ IonCom STRUM

TM-score TM-align MM-align NW-align LS-align EDTSurf MVP MVP-Fit SPICKER HAAD PSSpred 3DRobot MR-REX I-TASSER-MR NeBcon WDL-RF ATPbind

BioLiP E. coli GLASS GPCR-HGmod GPCR-RD GPCR-EXP TM-fold DECOYS POTENTIAL RW HPSF CASP7 CASP8 CASP9 CASP10 CASP11 CASP12

[back to server]

DEMO Results for job DO818527046

[Click on DO818527046.tar.bz2 to download the tarball file including all results listed on this page]


  Input Sequence in FASTA format

>query_protein (504 residues)
ETHTFNWTTGWDYRNVDGLKSRPVITCNGQFPWPDITVNKGDRVQIYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLTQCP
IAPGSTMLYNFTVDYNVGTYWYHSHTDGQYEDGMKGLFIIKDDSFPYDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAE
PIPQNLIVNNTMNLTWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDMLYITVAQRYTVLVHTKNDT
DKNFAIMQKFDDTMLDVIPSDLQLNATSYMVYNKTAALPTQNYVDSIDNFLDDFYLQPYEKEAIYGEPDHVITVDVVMDNLK
NGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGSNTHTFILEKDEIVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTY
DDALGEVPHSFDPDNHPAFPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLVEDPFGIQDAHSQQL
SENHLEVCQSCS

(Different color means different domains. 3 domains in total)

  Input Domain Structures

(By dragging your mouse on the images, you can rotate and zoom the structure)
Structure of domain 1 (download dom1.pdb) Structure of domain 2 (download dom2.pdb) Structure of domain 3 (download dom3.pdb)                               

  Template Structures Used for Assembly

  Top 5 templates for domain 1 and domain 2 assembly
 Rank  Template  SeqId __________________20__________________40__________________60__________________80_________________100_________________120_________________140_________________160_________________180_________________200_________________220_________________240_________________260_________________280_________________300_________________320_________________340_________________360_________________380_________________400_________________420_________________440_________________460_________________480_________________500
___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|____
QueryETHTFNWTTGWDYRNVDGLKSRPVITCNGQFPWPDITVNKGDRVQIYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLTQCPIAPGSTMLYNFTVDYNVGTYWYHSHTDGQYEDGMKGLFIIKDDSFPYDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAEPIPQNLIVNNTMNLTWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDMLYITVAQRYTVLVHTKNDTDKNFAIMQKFDDTMLDVIPSDLQLNATSYMVYNKTAALPTQNYVDSIDNFLDDFYLQPYEKEAIYGEPDHVITVDVVMDNLKNGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGSNTHTFILEKDEIVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSFDPDNHPAFPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLVEDPFGIQDAHSQQLSENHLEVCQSCS                    
11gw0a0.29VTQSYVFNLTEVNWMGPDGVVKKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPGGQRTYRWRAR-QYGTSWYHSHFSAQYGNGVVGTIQINGPA-SLPYDIDGVFPITDYYYRAADDLVHFTQN--N---APPFSDNVLINGTAYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAP-DNYWFNVTFGQAACG-GS--LNPHPAAIFHYGAPGGLPTDEGTPPVDHQLDTLDVRPVV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23g5wA0.18EKREFDLSIEDTRIVLVGKRDFHTFAFNGQVPAPLIHVMEGDDVTVNVTNMTT-LPHTIHWHGMLQRGTWQSDGVPHATQHAIEPGDTFTYKFKA-EPAGTMWYHCHVNEHVTRGMWGPLIVEPKNPLITVTKDYILMLSDWVSWAPGEGG--I--------PGDVFDYYTINAKSFTPIRVKKGDVIRLRLIGAG-DHVHAIHTHGHISQIAFKDGFPLKPIKGDTVLIGPGERYDVILNMDNP--GLWMIHDHVDT-------GDKPGGIMTTIEYGIDHFYVW--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
32xllA0.24EIWYYEVEIKPFTHQVYPLGSADLVGYD-GMSGPTFQVPRGVETVVRFINNAE-APNSVHLHGSFS--RAAFDGWAE---DITEPGSFKDYYYPNRQSARTLWYHDHAIANAYRGQAGLYMLTDPAEALNLPFDIPMILTSKQYVTTN-GE--L--------NSFWGDVIHVNGQPWPFKNVEP-RKYRFRFLDAAVSRSFGLYFARLPFKVIASDSGLLHPADTSLLYISMAERYEVVFDFSDYAGKTIELRNLGGSGTD--TD-YDNTDKVMRFVVAD-------------ARTVMPYESGL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
42wsdA0.23KKTYYEVTMEE-THQLHRLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSVKTVVHLHGGVT--PDDSDGYPE---AWFSKDFREVYHYPNQQRGAILWYHDHALLNVYAGLVGAYIIHDPKERLKLPYDVPLLITDRTILFY--P-SAPPSSLPS-VPAFCGETILVNGKVWPYLEVEP-RKYRFRVINASNTRTYNLSLDNGDFIQIGSDGGLLRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGC--G-GDVNPETDANIMQFRVTK-----------------VPPPPKGW-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
54e9sA0.24TTNRIQLTIGAGQST-FGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLT-EETTLHWHGLEV--PGEVDGGPQ--G-IIPPGGKRSVTLNVDQPAATCWFHPHQKRQVAMGLAGLVVIEDDEIKLMLPDDVPVIVQDKKFIDY--QL--DV---MTAAVGWFGDTLLTNGAIYPQHAAPR-GWLRLRLLNGCNARSLNFATSDRPLYVIASDGGLLEPVKVSELPVLMGERFEVLVEVN--DNKPFDLVTLPVSQMGM-AI--APFPHPMRIQPIA-----------------PPAAHAGW-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

  Top 5 templates for domain 2 and domain 3 assembly
 Rank  Template  SeqId __________________20__________________40__________________60__________________80_________________100_________________120_________________140_________________160_________________180_________________200_________________220_________________240_________________260_________________280_________________300_________________320_________________340_________________360_________________380_________________400_________________420_________________440_________________460_________________480_________________500
___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|___________________|____
QueryETHTFNWTTGWDYRNVDGLKSRPVITCNGQFPWPDITVNKGDRVQIYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLTQCPIAPGSTMLYNFTVDYNVGTYWYHSHTDGQYEDGMKGLFIIKDDSFPYDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAEPIPQNLIVNNTMNLTWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDMLYITVAQRYTVLVHTKNDTDKNFAIMQKFDDTMLDVIPSDLQLNATSYMVYNKTAALPTQNYVDSIDNFLDDFYLQPYEKEAIYGEPDHVITVDVVMDNLKNGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGSNTHTFILEKDEIVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSFDPDNHPAFPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLVEDPFGIQDAHSQQLSENHLEVCQSCS                    
11gw0a0.29------------------------------------------------------------------------------------------------------------------------------PSLPYDIDGVFPITDYYYRAADDLVHFTQN--N---APPFSDNVLINGTAYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAP-DNYWFNVTFGQAACG-GS--LNPHPAAIFHYGAPGGLPTDEGTPPVDHQLDTLDVRPVVPRSVPVSFVRDNTLPVALDLTGTPLFVWKVNGSDINVDGKPIIDYILTG--NT----SYPVSDNIVQVDVDQWTYWLIENDFSLPHPMHLHGHDFLVLGRSPDVPAASQQ-RFVFDPAVDARLNDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWR
22xllA0.24------------------------------------------------------------------------------------------------------------------------------ELNLPSFDIPMILTSKQYVTT-NGE--L--------NSFWGDVIHVNGQPWPFKNVEP-RKYRFRFLDAAVSRSFGLYFARLPFKVIASDSGLLHPADTSLLYISMAERYEVVFDFSDYAGKTIELRNLGGSGTD--TD-YDNTDKVMRFVVAD----------------------NLRDVPFPSPTTNTPRQFRFGRTG-----PTWTINGVAFADV---------------------Q-NRLLANVPVGTVERWELINAGNWTHPIHIHLVDFKVISRTSGNN----A----------TV-P-ESGLKDVVWLGRRETVVVEAHYAPPGVYMFHCHNLIHEDHDMMAAFNATVLPDYGYNATVEELWQARP-----
32wsdA0.23------------------------------------------------------------------------------------------------------------------------------ERLKLPYDVPLLITDRTILFY--P-SAPPSSLPS-VPAFCGETILVNGKVWPYLEVEP-RKYRFRVINASNTRTYNLSLDNGDFIQIGSDGGLLRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANS-AG-CG-GDVNPETDANIMQFRVTK----------------------YLASYPSQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWH-------------------------DPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRP-F-----DIAYELSY-GPAVPP-EKGWKDTIQAHAGEVLRIAATFGPYGRYVWHCHALEHEDYDMMRPMDITDP----------------------
44e9sA0.24------------------------------------------------------------------------------------------------------------------------------IKLMLPDDVPVIVQDKKFSQIDYQL--DV---MTAAVGWFGDTLLTNGAIYPQHAAPR-GWLRLRLLNGCNARSLNFATDNRPLYVIASDGGLLEPVKVSELPVLMGERFEVLVEVN--DNKPFDLVTLPVSQMGM-AI--APFPHPMRIQPIA----------------------TLSSLPALPSLGLTVRKLQLSMDMGGKFDFANKINGQAFDMN------------------------KPMFAAAKGQYERWVISGGDMMLHPFHIHGTQFRILSENG-----------------KPPAA-RAGWKDTVKVE-GNVSEVLVKFNHDAAYMAHCHLLEHEDTGMMLGFTVG------------------------
53gyrL0.23------------------------------------------------------------------------------------------------------------------------------EALGLPREIPLLIADRNLLLH-KTV-IVQQSNKPVSIPFFGPYTTVNGRIWPYADVDD-GWYRLRLVNASNARIYNLVLIVPVVHQIGSDGGLLRPVPVDVLSAAPAERFDLLVDFRALGGRRLRLVDKGPG-----PLGGVRYPEVMEFRVRE----------------------LSGSFRRMSDIPHGHRLIVLTPTKG--SGGHEIWERARTFN------------------------DGLGFTIGEGTHEQWTFLNLSPILHPMHIHLADFQVLGRDAYDAS----PVRLDP---PVPLP-ELGHKDVFQVPGPQGLRVMGKFDGAYRFMYHCHLLEHEDMGMMRPFVVMPPEAL-------------------

(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)           
(b)Rank of templates represents the top five structural aligenment templates identified by using TM-align.
(c)SeqId is the ratio between the number of identical residues and query length.

  List of top 200 templates for distance profile construction

domain 1 + domain 2: template_0.txt
domain 2 + domain 3: template_1.txt

  DEMO Assembled Structure

  

Colored by domain: domain 1 in red; domain 2 in blue; domain 3 in green.
(download assembled structure)

[back to server]
Reference:
  • Xiaogen Zhou, Jun Hu, Chengxin Zhang, Guijun Zhang, and Yang Zhang. Assembling multidomain protein structures through analogous global structural alignments. Proceedings of the National Academy of Sciences, 116: 15930-15938 (2019). [PDF] [Support Information]
  • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218