Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	N-formyl peptide receptor 2
Species	Homo sapiens (Human)
Gene	FPR2
Synonym	FPRH1 FPRH2 FPRL1 HM63 Lipoxin A4 receptor LXA4 receptor LXA4R FPR2A FPR2/ALX Fpr-rs2 ALX ALX/FPR2 ALXR FMLP-R-I FMLP-related receptor I FMLPX formyl peptide receptor 2 formyl peptide receptor, related sequence 2 Formyl peptide receptor-like 1 RFP [ Show all ]
Disease	N/A
Length	351
Amino acid sequence	METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
UniProt	P25090
Protein Data Bank	N/A
GPCR-HGmod model	P25090
3D structure model	This predicted structure model is from GPCR-EXP P25090.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4227
IUPHAR	223
DrugBank	N/A

Ligand

Name	4-Aminodiphenylamine
Molecular formula	C12H12N2
IUPAC name	4-N-phenylbenzene-1,4-diamine
Molecular weight	184.242
Hydrogen bond acceptor	2
Hydrogen bond donor	2
XlogP	2.5
Synonyms	Azoic diazo 22 (C.I. 37240) NCI-C02233 C.I. 76085 oxy acid black base CHEMBL572203 Tox21_300027 p-Anilinoaniline CTK3J6850 W-108912 Peltol BR II DTXSID7025895 Semidine FT-0694840 KSC496Q5B 2198-59-6 (mono-hydrochloride) N-(4-Aminophenyl)aniline 4-N-phenylbenzene-1,4-diamine N-Phenyl-p-aminoaniline Acna Black DF Base N4-phenylbenzene-1,4-diamine NCGC00164239-02 BDBM50303914 NSC-3401 C.I. Oxidation Base 2 ST029306 p-Aminodifenylamin CI Azoic Diazo Component 22 UBOB P0203 Diphenylamine, 4-amino- ZB004812 RP24476 Epitope ID:122685 SR-01000393954-1 I01-9814 1,4-Benzenediamine, N-phenyl- MCULE-6038560098 4-(phenylamino) aniline N-Fenyl-p-fenylendiamin [Czech] 76600-63-0 N-Phenyl-p-phenylenediamine, 98% AJ-12299 NCGC00254187-01 C.I. oxidation base 2 NSC37074 CHEBI:59038 TL8000096 P-AMINODIPHENYLAMINE cid_7564 Variamine Blue RT Base paraaminodiphenylamine DSSTox_GSID_25895 SCHEMBL15371 FT-0617574 KB-258528 101-54-2 MolPort-000-927-989 N-Phenyl-1,4-phenylenediamine AC1Q1IM4 n1-phenyl-1,4-benzenediamine ANW-43066 Azosalt R NE10520 C.I. Azoic Diazo Component 22 Oxy Acid Black Base CI 37240 TR-000392 p-Phenylenediamine, N-phenyl- Diphenyl Black WLN: ZR DMR phenyl 4-aminophenyl amine EC 202-951-9 SMR000129304 HMS2487O23 (4-aminophenyl)phenylamine LS-331 4'-Bianiline N-4'-Bianiline 4698-29-7 (sulfate [2:1]) N-phenyl-p-phenylene diamine acnablackdfbase Naphthoelan Navy Blue NCGC00164239-03 Black Base P NSC-37074 CAS-101-54-2 ST24031464 p-Aminodifenylamin [Czech] CI Developer 15 UNII-007X4XXS71 P260 Diphenylamine, p-amino- ZINC136186 RTR-000392 F0900-1525 InChI=1/C12H12N2/c13-10-6-8-12(9-7-10)14-11-4-2-1-3-5-11/h1-9,14H,13H 1,4-Benzenediamine, N1-phenyl- MFCD00007850 4-(Phenylamino)aniline N-Phenyl-1,4-benzenediamine AC-10080 N-Phenyl-p-phenylenediamine, capsule (15??mg) AKOS000120208 ATGUVEKSASEFFO-UHFFFAOYSA-N NCGC00259693-01 C.I. 37240 Oprea1_628520 Tox21_202144 p-AMINODIPHENYLAMINE, TECH CJ-01033 Variamine Blue Salt RT Peltol BR DSSTox_RID_77963 Semidin FT-0654824 KB-36520 12227-74-6 N, 4'-Bianiline 4-benzenediamine,n-phenyl-1 N-Phenyl-benzene-1,4-diamine AC1Q523C N1-phenylbenzene-1,4-diamine BB 0221229 NSC 3401 C.I. Developer 15 p-(Phenylamino)aniline CI 76085 TRA0005500 p-Semidine diphenyl black base P Z234894423 Rodol Gray B base EINECS 202-951-9 SR-01000393954 HSDB 2178 007X4XXS71 Luxan Black R 4-(N-phenylamino)-aniline N-Fenyl-p-fenylendiamin N-Phenyl-p-phenylenediamine AI3-15983 NCGC00164239-01 NCGC00164239-04 BRD-K47738216-003-01-9 NSC3401 CCRIS 513 STL263880 p-aminodiphenylamin CI Oxidation Base 2 Variamine Blue RT para-aminodiphenylamine DSSTox_CID_5895 SBB056688 Fast Blue R Salt Jsp000227 1-N-phenylbenzene-1,4-diamine MLS000518884 4-amino-diphenylamin N-phenyl-1,4-diaminobenzene AC1L1P1S N-phenylbenzene-1,4-diamine AN-24580 [ Show all ]
Inchi Key	ATGUVEKSASEFFO-UHFFFAOYSA-N
Inchi ID	InChI=1S/C12H12N2/c13-10-6-8-12(9-7-10)14-11-4-2-1-3-5-11/h1-9,14H,13H2
PubChem CID	7564
ChEMBL	CHEMBL572203
IUPHAR	N/A
BindingDB	50303914
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	<66700.0 nM	N/A	BindingDB
Ki	<40300.0 nM	N/A	BindingDB

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218