Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Muscarinic acetylcholine receptor M5
Species	Homo sapiens (Human)
Gene	CHRM5
Synonym	M5R M5 receptor cholinergic receptor cholinergic receptor, muscarinic 5
Disease	Urinary incontinence Colitis Dysmenorrhea Irritable bowel syndrome Myasthenia gravis Neurological disease Schizophrenia Stomach ulcer Cognitive disorders Chronic obstructive pulmonary disease Allergic rhinitis Central and peripheral nervous diseases Brain diseases Amnesia [ Show all ]
Length	532
Amino acid sequence	MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
UniProt	P08912
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	T79961
ChEMBL	CHEMBL2035
IUPHAR	17
DrugBank	BE0000247, BE0004890

Ligand

Name	tropicamide
Molecular formula	C17H20N2O2
IUPAC name	N-ethyl-3-hydroxy-2-phenyl-N-(pyridin-4-ylmethyl)propanamide
Molecular weight	284.359
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	1.5
Synonyms	MCULE-4102613027 SR-01000075351-1 Benzeneacetamide, N-ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)-, (+-)- Mydriacyl SW196691-3 BRD-A79672927-001-10-8 N-ethyl-3-hydroxy-2-phenyl-N-(4-pyridylmethyl)propanamide Tropicamid Chauvin Brand of Tropicamide NCGC00016065-04 Tropicamide Faure CTK4C6796 NCGC00024866-03 Tropicamide Pharmafair Brand DSSTox_RID_80757 NSC757372 Tropicamide, solid HMS1568N17 HMS3267A13 Prestwick1_000228 508T754 I06-0811 s1913 AC-816 KBioGR_000873 Spectro-Cyl AM84467 BBL028074 Minims tropicamide SR-01000075351-7 BGDKAVGWHJFAGW-UHFFFAOYSA-N Mydriaticum Tox21_110297 BSPBio_002289 N-Ethyl-N-(4-pyridylmethyl)tropamid CHEMBL1200604 NCGC00016065-07 Tropicamide Monofree NCGC00024866-06 Tropicamide [USAN:USP:INN:BAN:JAN] EINECS 216-140-2 Ocu-Tropic Tropicamidum [INN-Latin] HMS2092A18 Opticyl HMS3712N17 Prestwick_487 AB00052120-10 KBio1_000448 SCHEMBL23975 ACN-036667 KS-5174 Spectrum3_000655 LP01223 Spectrum_000584 Benzeneacetamide, N-ethyl-.alpha.-(hydroxymethyl)-N-(4-pyridinylmethyl)- MolPort-000-159-321 Stulln Brand 1 of Tropicamide BPBio1_000303 N-Ethyl-2-phenyl-N-4-[-pyridyl-methyl]hydracrylamide Triaminic DM CAS_1508-75-4 NC00589 Tropicamide Alcon Brand CPD000058523 NCGC00016065-11 Tropicamide Novartis Brand DSSTox_CID_25220 Novartis Brand of Tropicamide Tropicamide, (S)-Isomer FT-0657590 OcuTropic Visumidriatic HMS3259M18 Pharmakon1600-01500599 1508-75-4 Hydracrylamide, N-ethyl-2-phenyl-N-(4-pyridylmethyl)- Ro 1-7683 AB0011259 KBio2_006200 SPBio_000872 AKOS005664076 AN-15530 Medical Ophthalmics Brand of Tropicamide SR-01000075351-3 Benzeneacetamide,N-ethyl-a-(hydroxymethyl)-N-(4-pyridinylmethyl)- Mydriacyl (TN) T 9778 BRN 0285563 N-ethyl-3-hydroxy-2-phenyl-N-(pyridin-4-ylmethyl)propanamide Tropicamida CHEBI:9757 NCGC00016065-05 Tropicamide for peak identification, European Pharmacopoeia (EP) Reference Standard D00397 NCGC00024866-04 Tropicamide Rivex Brand DTXSID8045220 NSC_5593 Tropicamide, United States Pharmacopeia (USP) Reference Standard HMS1921I09 HMS3373B07 Prestwick2_000228 IDI1_000448 SAM002564235 AC1L1KOZ KBioSS_001064 SPECTRUM1500599 Spectrum4_000377 BCP13504 MLS001306442 ST51015162 Bistropamide Mydrum Tox21_110297_1 Cahill May Roberts Brand of Tropicamide N-Ethyl-N-(4-pyridylmethyl)tropamide Tropicamide (JP15/USP/INN) Colircusi Tropicamida NCGC00016065-08 Tropicamide Monohydrochloride, (R)-Isomer DB00809 NCGC00261908-01 Tropicamide, (+-)-Isomer Epitromina Ocumed Brand of Tropicamide Tropikamid HMS2095N17 Paremyd (+-)-N-Ethyl-2-phenyl-N-(4-pyridylmethyl)hydracrylamide HMS501G10 Q-201902 AB00052120_11 KBio2_001064 SMP1_000304 AK164485 L001262 LS-28545 SR-01000075351 Benzeneacetamide, N-ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)- Mydral Stulln Brand 2 of Tropicamide BRD-A79672927-001-05-8 N-Ethyl-3-hydroxy-2-phenyl-N-(4-pyridinylmethyl)propanamide # Tropicacyl CCG-40076 NCGC00016065-03 Tropicamide Chauvin Brand CS-2362 NCGC00024866-02 Tropicamide Ocumed Brand DSSTox_GSID_45220 NSC-757372 Tropicamide, European Pharmacopoeia (EP) Reference Standard GTPL7319 HMS3263F08 Prestwick0_000228 5-22-09-00359 (Beilstein Handbook Reference) I-Picamide RP29909 AB2000370 KBio3_001509 SPBio_002196 Alcon Brand of Tropicamide API0004531 MFCD00058580 SR-01000075351-5 BG0349 Mydriafair TL8001101 BSPBio_000275 N-Ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)benzeneacetamide Tropicamida [INN-Spanish] NCGC00016065-06 Tropicamide Minims D09PNY NCGC00024866-05 Tropicamide [USAN:INN:BANJAN] EBD22886 Ocu Tropic Tropicamidum HMS2089M05 HMS3651K04 Prestwick3_000228 AB00052120 K-4793 SBI-0051190.P003 AC1Q5IFA KS-00000H8Q Spectrum2_000936 Lopac0_001223 Spectrum5_001585 BDBM82371 MLS002154240 STK934612 Bournonville Brand of Tropicamide N-Ethyl-2-phenyl-N-(4-pyridylmethyl)hydracrylamide Tox21_501223 CAS-1508-75-4 n-ethyl-n-(g-picolyl)tropamide Tropicamide (JP17/USP/INN) component of Paremyd NCGC00016065-09 Tropicamide Monohydrochloride, (S)-Isomer DivK1c_000448 NINDS_000448 Tropicamide, (R)-Isomer EU-0101223 Ocusoft Brand of Tropicamide Tropimil HMS2235J15 Pharmafair Brand of Tropicamide HY-B0321 Rivex Brand of Tropicamide AB00052120_12 KBio2_003632 SMR000058523 Akorn Brand of Tropicamide [ Show all ]
Inchi Key	BGDKAVGWHJFAGW-UHFFFAOYSA-N
Inchi ID	InChI=1S/C17H20N2O2/c1-2-19(12-14-8-10-18-11-9-14)17(21)16(13-20)15-6-4-3-5-7-15/h3-11,16,20H,2,12-13H2,1H3
PubChem CID	5593
ChEMBL	CHEMBL1200604
IUPHAR	N/A
BindingDB	82371
DrugBank	DB00809
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	89.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL
Ki	64.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218