Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Trace amine-associated receptor 1
Species	Homo sapiens (Human)
Gene	TAAR1
Synonym	trace amine receptor 1 TAR1 TaR-1 TA1 receptor TRAR1
Disease	N/A
Length	339
Amino acid sequence	MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
UniProt	Q96RJ0
Protein Data Bank	N/A
GPCR-HGmod model	Q96RJ0
3D structure model	This predicted structure model is from GPCR-EXP Q96RJ0.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL5857
IUPHAR	364
DrugBank	BE0001044

Ligand

Name	Phenethylamine
Molecular formula	C8H11N
IUPAC name	2-phenylethanamine
Molecular weight	121.183
Hydrogen bond acceptor	1
Hydrogen bond donor	1
XlogP	1.4
Synonyms	EINECS 200-574-4 HMS2267J14 71750-39-5 (sulfate) LABOTEST-BB LT03331710 843-EP2281818A1 843-EP2371811A2 (2-phenylethyl)amine AKOS000119084 .beta.-Phenylethylamine hydrochloride b-phenylaethylamin 12463-EP2280001A1 beta-Phenethylamine 2-(aminoethyl)benzene BRN 0507488 2-penylethylamine D0Q6PI 2-Phenylethanamine # MLS001066395 NSC10811 phenethylamin phenethylarnine RL04441 ST24032521 2-phenylethaneamine F2190-0396 3-AMINOETHYLBENZENE I01-0392 79541-EP2305697A2 LS10634 843-EP2292619A1 (+)-alpha-Methylphenethylamine hemisulfate salt AC1Q54D9 .beta.-Phenethylamine AS00484 1-Phenyl-2-amino-athan BDBM10758 14C-phenylethylamine beta-Phenylaethylamin [German] 2-Amino-fenylethan CHEBI:18397 2-Phenethylamine, liquid Dextroamphetamine sulfate salt N-Benzylmethyl-amine P0085 Phenethylamine, 99% Polystyrene A-NH2 SBB058801 TR-000856 EBD27214 2-phenylethylamine FT-0613300 60BC7032-7CEC-4B97-B365-EA6E475E6E3C KS-000002OD 843-EP2272973A1 843-EP2308510A1 (2-Aminoethyl)benzene AI3-03117 .beta.-Phenylathylaminhydrochlorid b-aminoethylbenzene 1-Phenyl-2-aminoethane beta Phenethylamine 1utm bmse000377 2-Fenylethylamin CS-W011199 2-Phenylethan-1-Amine NSC 10811 phenethyl amine PHENETHYLAMINE, HYDROCHLORIDE Q-201553 SCHEMBL968 WLN: Z2R Ethanamine, 2-phenyl- 21691-EP2284174A1 HSDB 3526 79541-EP2305695A2 LABOTEST-BB LTBB000487 843-EP2284157A1 AC1L1AIE AN-23735 .omega.-Phenylethylamine b-phenylaethylamin (german) 12463-EP2314571A2 beta-Phenylaethylamin 2-(phenyl)ethylamine C05332 2-Phenethylamine DB-002852 2-phenylethanamine (ACD/Name 4.0) MLS001075768 omega-Phenylethylamine Phenylethyl amine RP19436 ST45255355 2-phenylethariamine FEMA 3220 327C7L2BXQ InChI=1/C8H11N/c9-7-6-8-4-2-1-3-5-8/h1-5H,6-7,9H 79541-EP2305698A2 MCULE-5305816256 843-EP2295439A1 (+)-alpha-Methylphenethylamine sulfate salt ACMC-1ATT1 .beta.-Phenethylamine hydrochloride AURORA KA-7805 1-Phenyl-2-amino-athan (GERMAN) Benzeneethanamine 156-28-5 (hydrochloride) beta-phenylethylamine 2-Amino-fenylethan [Czech] 2-phenyl-Ethanamine DL-BENZEDRINE SULFATE N-phenethylamine PARAGOS 510015 Phenethylamine, >=99% Polystyrene A-NH2, extent of labeling: 0.8-1.2 mmol/g loading SC-18356 TX-016680 EC 200-574-4 2-phenylethylamine (ACD/Name 4.0) GTPL2144 64-04-0 KSC353A6F 843-EP2277872A1 843-EP2308562A2 (2-Aminoethyl)polystyrene AJ-61320 .beta.-Phenylethylamine b-phenethylamine beta-Aminoethylbenzene 1uto BR-44044 2-Fenylethylamin [Czech] CTK2F3062 2-Phenylethanamine MFCD00008184 NSC-10811 phenethyl-amine Phenethylamine, purified by redistillation, >=99.5% RARECHEM AL BW 0047 SMR000471837 ZINC6579654 Ethylamine, 2-phenyl- 21691-EP2314571A2 HY-W010483 79541-EP2305696A2 LS-3025 843-EP2284174A1 (+)-A-METHYLPHENETHYLAMINE HEMISULFATE SALT AC1Q54BB .beta.-Aminoethylbenzene ANW-34793 1-Amino-2-phenylethane b-phenylethylamine 12463-EP2316826A1 beta-phenylaethylamin (german) 2-Amino-1-phenylethane C8H11N 2-Phenethylamine, analytical standard DB04325 2-phenylethanaminium MolPort-000-871-498 OTAVA-BB 1038619 Phenethylamine, .beta. phenylethylamine RTR-000856 STL264196 2-Phenylethyl amine FEMA No. 3220 5471-08-9 (sulfate[2:1]) KB-47544 843-EP2272972A1 843-EP2305260A1 (+/-)-ALPHA-METHYLPHENETHYLAMINE SULFATE SALT ACT01135 .beta.-Phenylaethylamin AZ0001-0092 1-Phenyl-2-amino-athan [German] benzylmethyl amine 1tnj BHHGXPLMPWCGHP-UHFFFAOYSA-N 2-Aminoethylbenzene CHEMBL610 2-phenyl-ethylamine DTXSID5058773 NCGC00163366-01 PHEA PHENETHYLAMINE, BETA PubChem21080 SCHEMBL330324 UNII-327C7L2BXQ [ Show all ]
Inchi Key	BHHGXPLMPWCGHP-UHFFFAOYSA-N
Inchi ID	InChI=1S/C8H11N/c9-7-6-8-4-2-1-3-5-8/h1-5H,6-7,9H2
PubChem CID	1001
ChEMBL	CHEMBL610
IUPHAR	2144
BindingDB	10758
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	100.0 - 630.957 nM	PMID11459929, PMID18524885, PMID17038507, PMID18602830, PMID19725810, PMID22073124	IUPHAR
EC50	106.0 nM	PMID22037049	BindingDB,ChEMBL
EC50	110.0 nM	MedChemComm, (2015) 6:12:2216	ChEMBL
EC50	129.0 nM	PMID18602830	BindingDB,ChEMBL
Emax	100.0 %	PMID18602830	ChEMBL

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218