Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	venlafaxine
Molecular formula	C17H27NO2
IUPAC name	1-[2-(dimethylamino)-1-(4-methoxyphenyl)ethyl]cyclohexan-1-ol
Molecular weight	277.408
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	2.9
Synonyms	N,N-dimethyl-2-(1-hydroxycyclohexyl)-2-(4-methoxyphenyl)ethylamine 1-{2-(dimethylamino)-1-[4-(methyloxy)phenyl]ethyl}cyclohexanol NCGC00095109-08 AB00053751_12 SCHEMBL35154 API0004581 Spectrum5_001516 C07187 Tox21_111425_1 CS-2129 Venlafaxine ER DB00285 WY-45655 Efectin HMS3714K11 KBio3_001877 LS-57095 1-(2-(dimethylamino)-1-(4-methoxyphenyl)ethyl)cyclohexanol NCGC00095109-02 93413-69-5 NSC_62923 AC-1547 SpecPlus_000842 BC209117 SR-01000762930-3 CAS_99300-78-4 Venlafaxina Cyclohexanol, 1-(2-(dimethylamino)-1-(4-methoxyphenyl)ethyl)-, hydrochloride VenlafaxineXR DSSTox_CID_3737 FT-0642242 K700 MolPort-003-666-534 1-[2-dimethylamino-1-(4-methoxylphenyl)ethyl]cyclohexanol NCGC00095109-05 AB00053751-10 SBI-0052740.P002 AKOS005555049 Spectrum3_000989 BRD-A51714012-003-01-1 STK621394 venlafaxine (Effexor) D08670 Venlafexine DTXSID6023737 HMS2090F04 KBio2_004719 (RS)-1-[2-(dimethylamino)-1-(4-methoxyphenyl)ethyl]cyclohexanol N,N-dimethyl-2-(1-hydroxycyclohexyl)-2-(4-methoxyphenyl)ethylamine; 1-[2-dimethylamino-1-(4-methoxyphenyl)ethyl]cyclohexan-1-ol; 1-[(1R)-2-(Dimethylamino)-1-(4-methoxyphenyl)ethyl]cyclohexanol 413V695 NSC-758676 AB00053751_13 SMR002204138 AT-6375 Spectrum_001671 CAS-93413-69-5 Venflaxine EP CTK8F8921 Venlafaxine [BAN:INN] DivK1c_006938 Efectin (TN) HSDB 6699 KBioGR_001590 MCULE-6632261838 1-[2-(dimethylamino)-1-(4-methoxyphenyl)ethyl]cyclohexan-1-ol NCGC00095109-03 99300-78-4 (hydrochloride) Pharmakon1600-01504171 AC1L1KU8 SPECTRUM1504171 BDBM82071 SR-01000762930-4 CCG-39577 Venlafaxina [INN-Spanish] Cyclohexanol, 1-[2-(dimethylamino)-1-(4-methoxyphenyl)ethyl]- Venlafaxinum DSSTox_GSID_23737 GTPL7321 KBio1_001882 N,N,O-Didesmethylvenlafaxine 1-[2-dimethylamino-1-(4-methoxyphenyl)ethyl]cyclohexan-1-ol NCGC00095109-06 AB00053751-11 SC-25322 AN-14846 Spectrum4_001115 BSPBio_002657 Tox21_111425 CHEMBL637 Venlafaxine (INN) D0P1UX Wy 45030 EC 618-944-2 HMS2093A12 KBio2_007287 NCGC00095109-01 NSC758676 AB1004809 SPBio_000583 AX8023170 SR-01000762930 CAS_93413-69-5 Venlafaxin Cyclohexanol, 1-(2-(dimethylamino)-1-(4-methoxyphenyl)ethyl)-, (+-)- Venlafaxine [INN:BAN] DL-Venlafaxine Elafax HY-B0196 KBioSS_002151 MLS006011859 1-[2-(Dimethylamino)-1-(4-methoxyphenyl)ethyl]cyclohexanol NCGC00095109-04 AB00053751-08 PNVNVHUZROJLTJ-UHFFFAOYSA-N AK116310 Spectrum2_000542 BRD-A51714012-001-02-3 ST24037045 CHEBI:9943 D,L-Venlafaxine Venlafaxinum [INN-Latin] DSSTox_RID_77175 HMS1922F05 KBio2_002151 [ Show all ]
Inchi Key	PNVNVHUZROJLTJ-UHFFFAOYSA-N
Inchi ID	InChI=1S/C17H27NO2/c1-18(2)13-16(17(19)11-5-4-6-12-17)14-7-9-15(20-3)10-8-14/h7-10,16,19H,4-6,11-13H2,1-3H3
PubChem CID	5656
ChEMBL	CHEMBL637
IUPHAR	N/A
BindingDB	82071
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	PMID7855217, PMID11454918, PMID16712488	PDSP,BindingDB
Ki	2004.0 nM	PMID11750180	PDSP,BindingDB

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218