Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	oxymetazoline
Molecular formula	C16H24N2O
IUPAC name	6-tert-butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethylphenol
Molecular weight	260.381
Hydrogen bond acceptor	2
Hydrogen bond donor	2
XlogP	2.9
Synonyms	NCGC00015766-09 BDBM30712 NCGC00022345-06 BSPBio_002145 Oximetazolinum Oxymetazolinum DivK1c_000567 Phenol, 6-t-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl- Duramist Plus Up To 12 Hour Nasal Decongestant Spray Prestwick3_000224 H-990 1491-59-4 KBio2_001531 6-tert-Butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethylphenol Lopac0_000903 AB00053513_14 NCGC00015766-01 Afrin Original 12 Hour Nose Drops Sinerol STK075254 Visine L.R Afrin, Dristan12-hrnasalspray, Ocuclear, Drixine NCGC00015766-13 BPBio1_000419 NINDS_000567 CAS-1491-59-4 oxymetazolina D08322 Oxymetozoline Drixoral Nasal Solution Phenol, 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl-(7CI,8CI) FT-0601532 HSDB 3143 3-[(4,5-Dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethylphenol KBio3_001645 6-tert-Butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethylphenol Nafrine AC1L1IM1 NCGC00015766-04 Rhinofrenol Spectrum2_000998 Tox21_110217_1 ZINC57435 NCGC00015766-07 AKOS007930348 NCGC00022345-04 BRN 0886303 Oximetazolina CCG-204985 oxymetazoline hydrochloride crystalline DB00935 Phenol, 3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl- (9CI) DSSTox_RID_79545 Prestwick1_000224 GTPL124 KB-302508 6-tert-butyl-3-((4,5-dihydro-1H-imidazol-2-yl)methyl)-2,4-dimethylphenol L000459 AB00053513-12 Navasin Afrin Extra Moisturizing 12 Hour Nasal Spray SCH-9384 Spectrum5_001114 Vicks Sinex 12 Hour Nasal Spray NCGC00015766-10 Biomol-NT_000161 Neo-Synephrine 12 Hour Spray C-16261 Oxylazine CHEMBL762 Oxymetazolinum [INN-Latin] Dristan Long Lasting Mentholated Nasal Spray Phenol, 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl- EINECS 216-079-1 Hazol 2-(4-tert-Butyl-2,6-dimethyl-3-hydroxybenzyl)-2-imidazoline KBio2_004099 6-tert-Butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethyl-phenol LS-104146 AB00053513_15 NCGC00015766-02 Afrin Original 12 Hour Pump Mist SPBio_001095 Tocris-1142 Visine L.R. AJ-09693 NCGC00015766-16 BRD-K16195444-001-01-7 Nostrilla 12 Hour Nasal Decongestant CAS-151615 D09EBS Phenol, 3-((4,5-dihydro-1H-imidazol-2-yl)methyl)-6-(1,1-dimethylethyl)-2,4-dimethyl- DSSTox_CID_20691 Phenol,3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl- FT-0650596 IDI1_000567 KBioGR_000908 6-tert-Butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethylphenol # Nasal Relief 12 Hour Nasal Spray Afrin NCGC00015766-05 Rhinolitan Spectrum3_000533 UNII-8VLN5B44ZY NCGC00015766-08 AN-10265 NCGC00022345-05 BSPBio_000267 Oximetazolina [INN-Spanish] CHEBI:7862 Oxymetazoline [INN:BAN] Decongestant (TN) Phenol, 3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl-(9CI) DTXSID3040691 Prestwick2_000224 H 990 KBio1_000567 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl-phenol;hydrochloride Lopac-O-2378 AB00053513-13 Navisin Afrin Original 12 Hour Nasal Spray SCHEMBL24301 Spectrum_001051 Vicks Sinex 12 Hour Ultra Fine Mist for Sinus Relief Afrin Sinus 12 Hour Nasal Spray NCGC00015766-11 BPBio1_000295 Nezeril C07363 oxymeta zoline cid_66259 Oxymethazoline Dristan Long Lasting Nasal Mist Phenol, 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl- (7CI,8CI) FT-0082560 HMS2089G03 3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethyl-6-tert-butyl-phenol KBio2_006667 6-tert-butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethyl-phenol;hydrochloride MCULE-8690625159 AC-6370 NCGC00015766-03 SPBio_002188 Tox21_110217 WYWIFABBXFUGLM-UHFFFAOYSA-N AK113123 NCGC00022345-02 BRD-K16195444-003-16-1 Operil (TN) CC-33432 Oxymetazoline (INN) Phenol, 3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl- DSSTox_GSID_40691 Prestwick0_000224 Genasal Nasal Spray Up to 12 Hour Relief Iliadin 6-t-Butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethylphenol KBioSS_001531 8VLN5B44ZY Nasivine (Salt/Mix) Afrin Cherry 12 Hour Nasal Spray NCGC00015766-06 SBI-0050878.P004 Spectrum4_000464 Vicks Sinex [ Show all ]
Inchi Key	WYWIFABBXFUGLM-UHFFFAOYSA-N
Inchi ID	InChI=1S/C16H24N2O/c1-10-8-13(16(3,4)5)15(19)11(2)12(10)9-14-17-6-7-18-14/h8,19H,6-7,9H2,1-5H3,(H,17,18)
PubChem CID	4636
ChEMBL	CHEMBL762
IUPHAR	124
BindingDB	30712
DrugBank	DB00935
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	578.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL
Ki	120.22 nM	PMID9225287	PDSP,BindingDB
Ki	158.489 - 501.187 nM	PMID10217294	IUPHAR
Ki	303.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218