[Zhang Lab Home] [NeBcon Server]

NeBcon predicted results for Job EXAMPLE


  Submitted Primary Sequence

>Length 113
GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLV
12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110

  Predicted Secondary Structure

>C-coil;H-helix;E-sheet;T-beta turn
GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLV
CCCCCCCCCEEEEECCCCCEEEEEECCCCCECCCCCEEEEEECCCCEEEEEECCCCEECCCCEEEEEECCCCCCCCCCCCEEECCCCCECCCCCEEEEEECCCCCEEEEEEEC
12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110

  Predicted Solvent Accessibility

>0-buried to 9-exposed
GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLV
95553525020330156231020304165524124020213268554120302360304132201010443536532232010432432121630200012463442143547
12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110

  Predicted Contact Map

Download carbon alpha contact map Download carbon beta contact map






























  Predicted beta-strands and beta-strand pairing

Score(antiparallel)=5.96
25         24         23         22         21         20                    
63         64         65         66         67         68                    
Score(antiparallel)=5.702
42         41         40         39         38         37         36                    
-          95         96         97         98         99         100                   
Score(antiparallel)=5.112
42         41         40         39         38         37         36                    
-          47         48         49         50         51         52                    
Score(antiparallel)=4.908
14         13         12         11         10         9                     
20         21         22         23         24         25                    
Score(antiparallel)=3.939
100        99         98         -          97         96         95                    
106        107        108        109        110        111        112                   
Score(antiparallel)=1.287
-          -          83         82         81         -                     
95         96         97         98         99         100                   

Download beta fragment alignment
Download reasonable beta strands