ResPRE result for job RPC136

User Input

> (82 residues)
EDPEVLFKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIP
MPPNAVSDDEAQTLAKWVLSQK

ResPRE Contact Prediction

The above plot displays the contact-map with a cutoff ≥0.5 of confidence score (ranging from 0 to 1). The full-length contact information for all residue pairs can be downloaded here in CASP RR format: Download contact-map data.

Reference:

Yang Li, Jun Hu, Chengxin Zhang, Dong-Jun Yu, and Yang Zhang. ResPRE: high-accuracy protein contact prediction by coupling precision matrix with deep residual neural networks. submitted, 2018.

[back to server]