[/home/overlord/I-TASSER5.1/example]> /home/overlord/I-TASSER5.1/I-TASSERmod/runI-TASSER.pl -pkgdir /home/overlord/I-TASSER5.1 -libdir /home/overlord/I-TASSER5.1/itlib -seqname example -datadir /home/overlord/I-TASSER5.1/example -outdir /home/overlord/I-TASSER5.1/output/example -runstyle gnuparallel -homoflag benchmark -idcut 0.3 -LBS true -EC true -GO true -java_home /usr/bin/java
Your setting for running I-TASSER is:
-pkgdir = /home/overlord/I-TASSER5.1
-libdir = /home/overlord/I-TASSER5.1/itlib
-java_home = /usr/bin/java
-seqname = example
-datadir = /home/overlord/I-TASSER5.1/example
-outdir = /home/overlord/I-TASSER5.1/output/example
-runstyle = gnuparallel
-homoflag = benchmark
-idcut = 0.3
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = true
-EC = true
-GO = true
Error: /usr/bin/java/bin/java does not exist.
Use /usr/bin/java instead.
1. make seq.txt and rmsinp
Your protein contains 143 residues:
> example
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLA
LQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVP
AHKGIGGNEQVDKLVSAGIRKVL
2.1 run Psi-blast
2.2 Predict secondary structure with PSSpred...
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 removing homology templates based on benchmark and 0.3
submit threading jobs first and run pair during threading
3.1 do threading
start gnuparallel threading PPAS
start gnuparallel threading dPPAS
start gnuparallel threading dPPAS2
start gnuparallel threading Env-PPAS
start gnuparallel threading MUSTER
start gnuparallel threading wPPAS
start gnuparallel threading wdPPAS
start gnuparallel threading wMUSTER
Can't use 'defined(@array)' (Maybe you should just omit the defined()?) at /usr/local/bin/parallel line 119.
only 0 threading programs have output, please check threading programs
cp: cannot stat 'model*.pdb': No such file or directory
cp: cannot stat 'init.*': No such file or directory
cp: cannot stat 'cscore': No such file or directory
cp: cannot stat 'lscore.txt': No such file or directory
cp: cannot stat 'rst.dat': No such file or directory
cp: cannot stat 'rep*tra*.*': No such file or directory