I'm running many jobs simultaneously via GNU parallels, but I'm noticing for a few of them they're stating that only a few (or sometimes 0) threading programs have output and the job has then stopped.
I suspect this is maybe the fault of parallels, and the the process has been dropped and a new job picked up prematurely, but I'm wondering if there is any way to restart the job from where it left off rather than begin all over again?
Here's some example output:
```
Your setting for running I-TASSER is:
-pkgdir = /home/ubuntu/Applications/itasser
-libdir = /home/ubuntu/Applications/itasser/itlib
-java_home = /usr/
-seqname = PAU_03392
-datadir = /home/ubuntu/resimulation/PAU_03392
-outdir = /home/ubuntu/resimulation/PAU_03392
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 149 residues:
> PAU_03392
MSTSTSQIAVEYPIPVYRFIVSVGDEKIPFNSVSGLDISYDTIEYRDGVGNWFKMPGQSQ
STNITLRKGVFPGKTELFDWINSIQLNQVEKKDITISLTNDAGTELLMTWNVSNAFPTSL
TSPSFDATSNDIAVQEITLMADRVIMQAV
2.1 run Psi-blast
2.2 Predict secondary structure with PSSpred...
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 Use all templates
2.4.2 running pair ................
pair done
3.1 do threading
start serial threading PPAS
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/PPAS_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 04:25:14 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running zalign .....
start serial threading dPPAS
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/dPPAS_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 04:25:19 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running zalign .....
start serial threading dPPAS2
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/dPPAS2_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 04:25:25 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running zalign .....
start serial threading Env-PPAS
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/Env-PPAS_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 04:25:32 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running zalign .....
start serial threading MUSTER
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/MUSTER_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 04:25:38 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running Psi-blast .....
running zalign .....
==>4ksrA2 4ksrA2 5.15368736951678 4.36121183396273
4ksrA2 4ksrA2 10 10
score_flag=1
ending time: Mon Jan 8 09:42:25 UTC 2018
start serial threading wPPAS
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/wPPAS_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 09:43:02 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running Psi-blast .....
ending time: Mon Jan 8 12:43:40 UTC 2018
start serial threading wdPPAS
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/wdPPAS_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 12:44:05 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running Psi-blast .....
start serial threading wMUSTER
/tmp/ubuntu/ITPAU_03392
/home/ubuntu/resimulation/PAU_03392/wMUSTER_PAU_03392
hostname: protein-simulation-2
starting time: Mon Jan 8 13:33:47 UTC 2018
pwd: /tmp/ubuntu/ITPAU_03392
running Psi-blast .....
running Psi-blast .....
==>4ksrA2 4ksrA2 5.76992730708662 5.02212180984095
4ksrA2 4ksrA2 10.74 10.74
score_flag=1
ending time: Mon Jan 8 21:28:03 UTC 2018
running pair now ................
30000 6379375 total lib str & residues
number of observations 20.28744 1351204.
pair done
only 3 threading programs have output, please check threading programs
```