I calculated a sequence of MSA files using the HHblits tool described in the ResPRE paper. The sequence name is d102ma_.
My problem is that the MSA file I get is different from the one in the example （T0759-D1.aln）provided.
What can I do to make my MSA file the same as that provided in the paper（T0759-D1.aln）?
The T0759-D1.aln file the paper provided is like this：
VVIHPDPGRELSPEEAHRAGLIDWNMFVKLRSQE
VVIHPDTGRELSPEEAHRVGLIDWNMFVKLRSQE
VVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQE
VVIDPDTGRELSPEEAHRAGLIDWKMFVKLRSQE
S----------STPTRHGAGLIDRAMFDRLRGQE
...............
The MSA result d102ma_.hhr obtained by using d102ma_ via hhblits is like this：
Query d102ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
Match_columns 154
No_of_seqs 752 out of 845
Neff 7.12999
Searched_HMMs 1849
Date Mon Nov 25 00:54:27 2019
Command hhblits -i ./seq/d102ma_.fa -d ../src/uniclust30/uniclust30_2018_08
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 sp|P10060|HBB1_SPHPU Hemoglobi 100.0 6.1E-54 2.3E-59 318.3 0.0 145 2-148 2-146 (146)
2 tr|A0A1K0GUW6|A0A1K0GUW6_PONAB 100.0 7.7E-54 2.6E-59 324.1 0.0 145 2-148 48-192 (192)
3 sp|P81024|HBAD_MELGA Hemoglobi 100.0 7.1E-52 2.9E-57 308.9 0.0 140 2-148 1-141 (141)
4 tr|L8HU81|L8HU81_9CETA Unchara 100.0 1.9E-50 6.2E-56 293.3 0.0 145 2-148 3-151 (151)
5 tr|H3B4U9|H3B4U9_LATCH Cytoglo 100.0 1.1E-48 4.1E-54 296.8 0.0 153 1-153 17-172 (179)
6 tr|A0A1I7Q446|A0A1I7Q446_CHICK 100.0 3.2E-48 1.1E-53 284.0 0.0 137 1-148 7-143 (143)
7 tr|A0A146ZNV6|A0A146ZNV6_FUNHE 100.0 4.7E-47 1.6E-52 285.6 0.0 143 1-148 47-189 (189)
8 tr|H3A6U9|H3A6U9_LATCH Unchara 100.0 2.1E-46 7E-52 297.7 0.0 145 2-148 149-304 (304)
...............
Thank you！