| Swiss ID: opsr_human |
| Protein Name: Red-sensitive opsin (Red cone photoreceptor pigmen |
| Organism: Homo sapiens (Human). |
| Seqeunce Length: 364 |
| MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM IFVVTASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFV LGHPMCVLEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIVGIAFSWIWS AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCIIPLAIIMLCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVCWGPYTFFACFAAANPGYAFH PLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS VSPA |
| Multiple Sequence Alignment |
| Experimental Restraints: |
| : MSA PMID of associated paper: 0 |
| Orientation Restraint: Y277 PMID of associated paper: 8185948 |
| Orientation Restraint: T285 PMID of associated paper: 8185948 |
| Orientation Restraint: T65 PMID of associated paper: 8185948 |
| Orientation Restraint: I230 PMID of associated paper: 8185948 |
| Orientation Restraint: Y309 PMID of associated paper: 8185948 |
| Experimental Data: |
| Experimental Data: Y277F PMID of associated paper: 8185948 |
| Experimental Data: T285A PMID of associated paper: 8185948 |
| Experimental Data: T65I PMID of associated paper: 8185948 |
| Experimental Data: I230T PMID of associated paper: 8185948 |
| Experimental Data: Y309F PMID of associated paper: 8185948 |
| Experimental Data: S180A PMID of associated paper: 8185948 |
| Experimental Data: Y277F PMID of associated paper: 8185948 |
| Experimental Data: T285A PMID of associated paper: 8185948 |
| Experimental Data: T65I PMID of associated paper: 8185948 |
| Experimental Data: I230T PMID of associated paper: 8185948 |
| Experimental Data: A233S PMID of associated paper: 8185948 |
| Experimental Data: Y309F PMID of associated paper: 8185948 |
| Experimental Data: MSA PMID of associated paper: 0 |
| GPCR Related Corss-reference Links: |
| GPCRDB GPCR-OKB UniProt_P04000 |