LOMETS (LOcal MEta-Threading-Server) results for test

>test, contains 298 residues, "easy" target

  Predicted Secondary Structure (by PSI-PRED)


Seq:DFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMYFFLSNLSLLD
SS :CEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
Pos:123456789012345678901234567890123456789012345678901234567890

Seq:ICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMALDRYIAVCKPL
SS :HHHHCCCHHHHHHHHCCCCCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Pos:123456789012345678901234567890123456789012345678901234567890

Seq:HYVVIMNPRLCQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICEVPALLKLACV
SS :CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCCCCCCEECCHHHHHHHHCC
Pos:123456789012345678901234567890123456789012345678901234567890

Seq:DTTVNELVLFVVSVLFVVIPPALISISYGFITQAVLRIKSVEARHKAFSTCSSHLTVVII
SS :CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCHHHHHHHHHH
Pos:123456789012345678901234567890123456789012345678901234567890

Seq:FYGTIIYVYLQPSDSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDMKEALRKLLSGK
SS :HHHHHHEEEECCCCCCCCCCCCEEEEEHHCHHHCCCCHHHCCCCHHHHHHHHHHHCCC
Pos:1234567890123456789012345678901234567890123456789012345678

For detailed information about output, please see readme file.



  Top 10 Models Selected by LOMETS

model 1 model 2 model 3 model 4 model 5
model 6 model 7 model 8 model 9 model 10


Details:


The Top 10 models selected by confidence score are provided below. The "Confidence Score" column indicates the confidence of the predicted template which is based on a scoring function that takes into account the Z-score of the template, the confidence of the particular server and the sequence identity between the query and the template. More information on the Confidence score and the template ranking scheme can be found here


RankTemplateAlign_lengthCoverageZscoreSeq_idConfidence ScoreProgramTarget-template alignments3-D models from threading alignmentsFull-length models by MODELLER
14bvn_A2760.92629.4660.17HighHHSEARCHalignment_1threading_1model_1
22ydoa2830.94936.8750.17HighcdPPASalignment_2threading_2model_2
33emlA12740.91917.9610.20HighPROSPECT2alignment_3threading_3model_3
43emlA12740.91952.7070.20HighwdPPASalignment_4threading_4model_4
52ydoa2720.91233.7610.19HighSP3alignment_5threading_5model_5
63emlA12730.91636.9400.19HighNeff-PPASalignment_6threading_6model_6
73emlA12740.91923.7990.19HighMUSTERalignment_7threading_7model_7
83emlA12620.87964.2000.19HighPRCalignment_8threading_8model_8
94ea3A02680.89917.3220.17HighpGenTHREADERalignment_9threading_9model_9
102rh1_A2790.93627.7350.17HighHHSEARCH2alignment_10threading_10model_10





  Restraint Files by LOMETS Consensus Method


  • Sidechain contacts
  • C alpha atom contacts
  • Short-range C alpha atom distances
  • Large-range C alpha atom distances



      Top 10 models for Each Threading Programs


    1.Models generated by SPARKS-X


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    13pblA12590.86915.6300.18Highalignment_1threading_1
    24iaqA12620.87915.4600.22Highalignment_2threading_2
    33uonA12630.88215.3600.17Highalignment_3threading_3
    43rzeA12540.85214.9100.17Highalignment_4threading_4
    54n6hA22730.91614.8200.18Highalignment_5threading_5
    64mbsA12670.89514.4300.18Highalignment_6threading_6
    72vt4B2620.87914.3100.17Highalignment_7threading_7
    84ea3B22630.88214.0500.16Highalignment_8threading_8
    93sn6R22620.87913.9200.17Highalignment_9threading_9
    104grvA12780.93213.8200.16Highalignment_10threading_10



    2.Models generated by FFAS-3D


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    13v2y_A12650.88970.4000.20Highalignment_1threading_1
    23v2w_A12520.84566.7000.19Highalignment_2threading_2
    33eml_A12660.89263.3000.20Highalignment_3threading_3
    43d4s_A12650.88961.8000.17Highalignment_4threading_4
    52rh1_A12690.90261.7000.17Highalignment_5threading_5
    63uon_A12670.89561.6000.18Highalignment_6threading_6
    74daj_A12580.86560.8000.16Highalignment_7threading_7
    83rze_A12590.86960.5000.17Highalignment_8threading_8
    94amj_B2670.89560.3000.18Highalignment_9threading_9
    101gzm_A2640.88560.2000.21Highalignment_10threading_10



    3.Models generated by HHSEARCH2


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    12rh1_A2790.93627.7350.17Highalignment_1threading_1
    23uon_A2750.92227.6480.18Highalignment_2threading_2
    34iar_A2740.91927.6380.22Highalignment_3threading_3
    44bvn_A2780.93227.5230.17Highalignment_4threading_4
    54phu_A2590.86927.5130.15Highalignment_5threading_5
    64dkl_A2760.92626.9370.18Highalignment_6threading_6
    74pxz_A2680.89926.9270.17Highalignment_7threading_7
    83vw7_A2720.91226.9170.13Highalignment_8threading_8
    93rze_A2650.88926.9070.18Highalignment_9threading_9
    104grv_A2800.93926.8970.16Highalignment_10threading_10



    4.Models generated by MUSTER


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    13emlA12740.91923.7990.19Highalignment_1threading_1
    23rzeA12600.87212.0390.17Highalignment_2threading_2
    33d4sA12690.90212.0320.18Highalignment_3threading_3
    43uonA12640.88511.9620.17Highalignment_4threading_4
    54grvA12710.90911.7880.20Highalignment_5threading_5
    63v2wA12620.87911.6890.18Highalignment_6threading_6
    72rh1A12720.91211.6170.18Highalignment_7threading_7
    82vt4B2670.89511.5350.18Highalignment_8threading_8
    94djhA12790.93611.3690.18Highalignment_9threading_9
    103pblA12580.86511.2220.18Highalignment_10threading_10



    5.Models generated by HHSEARCH I


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    14bvn_A2730.91631.1520.18Highalignment_1threading_1
    24buo_A2810.94231.1160.19Highalignment_2threading_2
    31u19_A2800.93930.0850.21Highalignment_3threading_3
    42lnl_A2820.94630.0750.17Highalignment_4threading_4
    52r4r_A1990.66729.4490.21Highalignment_5threading_5
    64phu_A2560.85928.8500.16Highalignment_6threading_6
    73odu_A2820.94627.7710.17Highalignment_7threading_7
    82rh1_A2770.92926.2600.17Highalignment_8threading_8
    93eml_A2730.91625.9960.21Highalignment_9threading_9
    104ea3_A2640.88525.5170.17Highalignment_10threading_10



    6.Models generated by Neff-PPAS


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    13emlA12730.91636.9400.19Highalignment_1threading_1
    23uonA12690.90217.7300.17Highalignment_2threading_2
    34iaqA12700.90617.2620.20Highalignment_3threading_3
    43d4sA12670.89516.9510.18Highalignment_4threading_4
    52vt4B2680.89916.8470.18Highalignment_5threading_5
    63v2wA12640.88516.7660.17Highalignment_6threading_6
    72rh1A12710.90916.6950.17Highalignment_7threading_7
    84grvA12790.93616.6510.17Highalignment_8threading_8
    93rzeA12610.87516.4960.16Highalignment_9threading_9
    104ea3B22690.90216.1700.14Highalignment_10threading_10



    7.Models generated by wdPPAS


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    13emlA12740.91952.7070.20Highalignment_1threading_1
    22vt4B2670.89529.4000.17Highalignment_2threading_2
    33rzeA12570.86229.2850.18Highalignment_3threading_3
    42vt4A2690.90229.1010.18Highalignment_4threading_4
    53d4sA12660.89228.9160.18Highalignment_5threading_5
    63uonA12560.85928.6400.17Highalignment_6threading_6
    72rh1A12660.89228.3640.16Highalignment_7threading_7
    83v2wA12550.85528.0410.18Highalignment_8threading_8
    93pblA12560.85927.8110.19Highalignment_9threading_9
    104iaqA12510.84226.5210.22Highalignment_10threading_10



    8.Models generated by HHSEARCH


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    14bvn_A2760.92629.4660.17Highalignment_1threading_1
    24iar_A2720.91229.1950.22Highalignment_2threading_2
    32r4r_A1980.66429.1420.20Highalignment_3threading_3
    44buo_A2820.94628.4950.17Highalignment_4threading_4
    51u19_A2890.96927.9790.19Highalignment_5threading_5
    62lnl_A2800.93927.6820.17Highalignment_6threading_6
    74phu_A2550.85527.6720.15Highalignment_7threading_7
    82rh1_A2790.93627.4020.17Highalignment_8threading_8
    93uon_A2740.91926.7380.18Highalignment_9threading_9
    104dkl_A2740.91926.5720.18Highalignment_10threading_10



    9.Models generated by SP3


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    12ydoa2720.91233.7610.19Highalignment_1threading_1
    21l9ha2790.93631.3200.18Highalignment_2threading_2
    33emla2300.77128.9280.20Highalignment_3threading_3
    43vg9a2660.89224.1780.20Highalignment_4threading_4
    54amia2670.89523.9240.19Highalignment_5threading_5
    62vt4a2630.88223.4580.20Highalignment_6threading_6
    74gbra2750.92223.2900.16Highalignment_7threading_7
    83pwha2590.86922.7530.21Highalignment_8threading_8
    93uzaa2580.86522.6960.21Highalignment_9threading_9
    104eiya2370.79522.6550.21Highalignment_10threading_10



    10.Models generated by FFAS03


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    14iaqA12580.86538.1000.21Highalignment_1threading_1
    21gzmA2750.92237.7000.19Highalignment_2threading_2
    33v2wA12510.84237.7000.19Highalignment_3threading_3
    42z73A2600.87237.3000.17Highalignment_4threading_4
    53rzeA12600.87237.3000.18Highalignment_5threading_5
    63uonA12670.89536.9000.18Highalignment_6threading_6
    73sn6R22700.90636.8000.17Highalignment_7threading_7
    83sn6R2700.90636.3000.17Highalignment_8threading_8
    92vt4A2700.90636.3000.18Highalignment_9threading_9
    103pblA12570.86233.5000.19Highalignment_10threading_10



    11.Models generated by cdPPAS


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    12ydoa2830.94936.8750.17Highalignment_1threading_1
    23uzaa2810.94236.1320.17Highalignment_2threading_2
    33pwha2810.94235.9010.17Highalignment_3threading_3
    42vt4a2740.91935.4220.16Highalignment_4threading_4
    54amia2800.93935.1080.15Highalignment_5threading_5
    63p0ga2780.93233.0440.17Highalignment_6threading_6
    73vg9a2830.94932.7630.18Highalignment_7threading_7
    84gbra2860.95932.7460.14Highalignment_8threading_8
    94gpoa2770.92932.7130.17Highalignment_9threading_9
    102y00a2840.95332.4160.15Highalignment_10threading_10



    12.Models generated by pGenTHREADER


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    14ea3A02680.89917.3220.17Highalignment_1threading_1
    24buoA02750.92216.4750.16Highalignment_2threading_2
    32z73A02770.92916.3410.17Highalignment_3threading_3
    41u19A02720.91216.2230.18Highalignment_4threading_4
    52rh1A02140.71813.8160.15Highalignment_5threading_5
    62lnlA02800.93913.1220.16Highalignment_6threading_6
    74grvA02530.84812.4290.19Highalignment_7threading_7
    83emlA02110.70812.4290.19Highalignment_8threading_8
    94eiyA02730.91611.6180.18Highalignment_9threading_9
    104mbsA02690.90210.4140.17Highalignment_10threading_10



    13.Models generated by PROSPECT2


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    13emlA12740.91917.9610.20Highalignment_1threading_1
    23rzeA12580.8657.4820.19Highalignment_2threading_2
    33uonA12610.8757.4570.19Highalignment_3threading_3
    42rh1A12710.9097.4250.18Highalignment_4threading_4
    52vt4A2660.8927.1570.20Highalignment_5threading_5
    64iaqA12720.9126.8830.23Highalignment_6threading_6
    73sn6R22700.9066.4650.19Highalignment_7threading_7
    83pblA12590.8696.3920.18Highalignment_8threading_8
    94iaqA2870.9636.2790.18Highalignment_9threading_9
    104ea3B22580.8656.1540.18Highalignment_10threading_10



    14.Models generated by PRC


    RankTemplateAlign_lengthCoverageZscoreSeq_idConfidenceTarget-template alignments3-D models from threading alignments
    13emlA12620.87964.2000.19Highalignment_1threading_1
    23emlA2670.89556.8000.19Highalignment_2threading_2
    34grvA2660.89254.4000.17Highalignment_3threading_3
    44grvA12740.91953.9000.16Highalignment_4threading_4
    53v2wA12400.80553.9000.17Highalignment_5threading_5
    63sn6R2770.92952.5000.17Highalignment_6threading_6
    72rh1A12730.91652.0000.16Highalignment_7threading_7
    83sn6R22710.90951.8000.17Highalignment_8threading_8
    94n6hA2790.93651.8000.16Highalignment_9threading_9
    103rzeA12530.84851.5000.17Highalignment_10threading_10



    Reference: S Wu, Y Zhang. LOMETS: A local meta-threading-server for protein structure prediction. Nucleic Acids Research, 35: 3375-3382 (2007).