the error just like that::
zp@ubuntu:~/I-TASSER4.1$ ./I-TASSERmod/runI-TASSER.pl -pkgdir /home/zp/I-TASSER4.1 -libdir /home/zp/ITLIB -LBS true -EC true -java_home /usr/ -seqname seq -datadir /home/zp/example -light true -hours 6 -outdir /home/zp/results
Your setting for running I-TASSER is:
-pkgdir = /home/zp/I-TASSER4.1
-libdir = /home/zp/ITLIB
-java_home = /usr/
-seqname = seq
-datadir = /home/zp/example
-outdir = /home/zp/results
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = true
-hours = 6
-LBS = true
-EC = true
-GO = false
1. make seq.txt and rmsinp
Your protein contains 143 residues:
> seq
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLA
LQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVP
AHKGIGGNEQVDKLVSAGIRKVL
2.1 run Psi-blast
2.2 Secondary structure prediction was done before.
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 Use all templates
2.4.2 running pair ................
./pair: 5: ./pair: Syntax error: "(" unexpected
pair done
cp: cannot stat ‘pair.3’: No such file or directory
cp: cannot stat ‘pair.1’: No such file or directory
3.1 do threading
start serial threading PPAS
/tmp/zp/ITseq
/home/zp/example/PPAS_seq
./zalign: 1: ./zalign: ELF: not found
./zalign: 2: ./zalign: @8@@@r: not found
./zalign: 3: ./zalign: r: not found
./zalign: 4: ./zalign: x: not found
./zalign: 5: ./zalign: xjxj??lIN: not found
./zalign: 1: ./zalign: Syntax error: Unterminated quoted string
Illegal division by zero at /home/zp/example/PPAS_seq line 354.
hostname: ubuntu
starting time: Wed Oct 8 15:58:26 PDT 2014
pwd: /tmp/zp/ITseq
running zalign .....
start serial threading dPPAS
/tmp/zp/ITseq
/home/zp/example/dPPAS_seq
./zalign: 3: ./zalign: Syntax error: word unexpected (expecting ")")
Illegal division by zero at /home/zp/example/dPPAS_seq line 356.
hostname: ubuntu
starting time: Wed Oct 8 15:58:29 PDT 2014
pwd: /tmp/zp/ITseq
running zalign .....
start serial threading dPPAS2
/tmp/zp/ITseq
/home/zp/example/dPPAS2_seq
./zalign: 3: ./zalign: Syntax error: word unexpected (expecting ")")
Illegal division by zero at /home/zp/example/dPPAS2_seq line 355.
hostname: ubuntu
starting time: Wed Oct 8 15:58:31 PDT 2014
pwd: /tmp/zp/ITseq
running zalign .....
start serial threading Env-PPAS
/tmp/zp/ITseq
/home/zp/example/Env-PPAS_seq
./zalign: 2: ./zalign: Syntax error: word unexpected (expecting ")")
Illegal division by zero at /home/zp/example/Env-PPAS_seq line 352.
hostname: ubuntu
starting time: Wed Oct 8 15:58:32 PDT 2014
pwd: /tmp/zp/ITseq
running zalign .....
start serial threading MUSTER
/tmp/zp/ITseq
/home/zp/example/MUSTER_seq
./svm-predict: 1: ./svm-predict: Syntax error: "(" unexpected
./svm-predict: 1: ./svm-predict: Syntax error: "(" unexpected
./zalign: 1: ./zalign: Syntax error: "(" unexpected (expecting ")")
Illegal division by zero at /home/zp/example/MUSTER_seq line 599.
hostname: ubuntu
starting time: Wed Oct 8 15:58:34 PDT 2014
pwd: /tmp/zp/ITseq
running Psi-blast .....
running zalign .....
start serial threading wPPAS
/tmp/zp/ITseq
/home/zp/example/wPPAS_seq
Illegal division by zero at /home/zp/example/wPPAS_seq line 343.
hostname: ubuntu
starting time: Wed Oct 8 16:04:05 PDT 2014
pwd: /tmp/zp/ITseq
running Psi-blast .....
start serial threading wdPPAS
/tmp/zp/ITseq
/home/zp/example/wdPPAS_seq
Illegal division by zero at /home/zp/example/wdPPAS_seq line 351.
hostname: ubuntu
starting time: Wed Oct 8 16:12:25 PDT 2014
pwd: /tmp/zp/ITseq
running Psi-blast .....
start serial threading wMUSTER
/tmp/zp/ITseq
/home/zp/example/wMUSTER_seq
./svm-predict: 1: ./svm-predict: Syntax error: "(" unexpected
./svm-predict: 1: ./svm-predict: Syntax error: "(" unexpected
Illegal division by zero at /home/zp/example/wMUSTER_seq line 570.
hostname: ubuntu
starting time: Wed Oct 8 16:22:07 PDT 2014
pwd: /tmp/zp/ITseq
running Psi-blast .....
running Psi-blast .....
running pair now ................
./pair: 5: ./pair: Syntax error: "(" unexpected
pair done
cp: cannot stat ‘pair.3’: No such file or directory
cp: cannot stat ‘pair.1’: No such file or directory
only 0 threading programs have output, please check threading programs
cp: cannot stat ‘model*.pdb’: No such file or directory
cp: cannot stat ‘init.*’: No such file or directory
cp: cannot stat ‘cscore’: No such file or directory
cp: cannot stat ‘lscore.txt’: No such file or directory
cp: cannot stat ‘rst.dat’: No such file or directory
cp: cannot stat ‘rep*tra*.*’: No such file or directory