Hello,
Does I-Tasser required installation of Fortran?, because I ran the I-Tasser and got the following error, for example:"Fortran runtime error: Permission denied
Illegal division by zero at /u/efratk/itasser/1A/MUSTER_1A line 599".
The output:
Your setting for running I-TASSER is:
-pkgdir = /usr/local/I-TASSER4.1
-libdir = /usr/local/I-TASSER4.1
-java_home = /usr/
-seqname = 1A
-datadir = /u/efratk/itasser/1A
-outdir = /u/efratk/itasser/1A
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 147 residues:
> 1A
VVAWLSRAEWDQVTVYLFCDDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLD
VTGGLGTDELRLLYGMALVRFVNLISERKTKFAKVPLKCLAQEVNIPDWIVDLRHELTHK
KMPHINDCRRGCYFVLDWLQKTYWCRQ
2.1 run Psi-blast
2.2 Predict secondary structure with PSSpred...
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 Use all templates
2.4.2 running pair ................
FORTRAN STOP
30000 6379375 total lib str & residues
number of observations 21.56657 1398096.
pair done
3.1 do threading
start serial threading PPAS
/tmp/efratk/IT1A
/u/efratk/itasser/1A/PPAS_1A
open: Permission denied
apparent state: unit 30 named /usr/local/I-TASSER4.1/summary/AAA.sec
last format: list io
lately reading sequential formatted external IO
Illegal division by zero at /u/efratk/itasser/1A/PPAS_1A line 354.
hostname: tamnun
starting time: Sun Nov 2 23:28:51 IST 2014
pwd: /tmp/efratk/IT1A
running zalign .....
start serial threading dPPAS
/tmp/efratk/IT1A
/u/efratk/itasser/1A/dPPAS_1A
At line 273 of file ppa1.f
Fortran runtime error: Permission denied
Illegal division by zero at /u/efratk/itasser/1A/dPPAS_1A line 356.
hostname: tamnun
starting time: Sun Nov 2 23:28:55 IST 2014
pwd: /tmp/efratk/IT1A
running zalign .....
start serial threading dPPAS2
/tmp/efratk/IT1A
/u/efratk/itasser/1A/dPPAS2_1A
At line 273 of file ppa1.f
Fortran runtime error: Permission denied
Illegal division by zero at /u/efratk/itasser/1A/dPPAS2_1A line 355.
hostname: tamnun
starting time: Sun Nov 2 23:28:57 IST 2014
pwd: /tmp/efratk/IT1A
running zalign .....
start serial threading Env-PPAS
/tmp/efratk/IT1A
/u/efratk/itasser/1A/Env-PPAS_1A
At line 284 of file zal3.f
Fortran runtime error: Permission denied
Illegal division by zero at /u/efratk/itasser/1A/Env-PPAS_1A line 352.
hostname: tamnun
starting time: Sun Nov 2 23:28:59 IST 2014
pwd: /tmp/efratk/IT1A
running zalign .....
start serial threading MUSTER
/tmp/efratk/IT1A
/u/efratk/itasser/1A/MUSTER_1A
At line 354 of file zal33.f
Fortran runtime error: Permission denied
Illegal division by zero at /u/efratk/itasser/1A/MUSTER_1A line 599.
hostname: tamnun
starting time: Sun Nov 2 23:29:00 IST 2014
pwd: /tmp/efratk/IT1A
running Psi-blast .....
running zalign .....
./zalign 7.01 0.55 0.66 1.6 -0.99 0.31 0.19 0 1.0 0.39 0.19
Thanks