Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	pramipexole
Molecular formula	C10H17N3S
IUPAC name	(6S)-6-N-propyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2,6-diamine
Molecular weight	211.327
Hydrogen bond acceptor	4
Hydrogen bond donor	2
XlogP	1.9
Synonyms	FT-0651622 K-0425 Mirapex (6S)-N6-propyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2,6-diamine NCGC00167441-01 (S)-Pramipexole Pramipexole (USAN/INN) 2-amino-6-propylaminotetrahydrobenzothiazole s2460 AB00053772_14 SND-919 BDBM50116766 ST24036373 CS-2510 U-98528E DivK1c_006916 HMS2090C15 KBio2_004908 (-)-Pramipexole Mirapexin (TN) (s)-2-amino-6-propylamino-4,5,6,7-tetrahydrobenzothiazole Oprymea 111GE001 Pramipexole [USAN:INN:BAN] 83619PEU5T SCHEMBL35376 AC1L3P1T Spectrum5_001453 CCG-100823 SUD919CL2Y D05575 DSSTox_GSID_23496 HY-B0410 KS-00000A3W (6S)-N'-propyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2,6-diamine MolPort-003-849-957 (S)-N6-Propyl-4,5,6,7-tetrahydrobenzothiazole-2,6-diamine 2,6-Benzothiazolediamine, 4,5,6,7-tetrahydro-N6-propyl-, (S)- Pramipexolum [Latin] AB00053772-12 SMR000449298 ANW-64032 SR-01000763219-5 CHEMBL301265 Tox21_112445 EC 600-593-1 GTPL953 KBio1_001860 Mirapex (TN) (s)-(-)-2-amino-6-n-propylamino-4,5,6,7-tetrahydrobenzothiazole NCGC00167441-02 1-(4-Fluorophenyl)-4-[4-(2-pyridinyl)-1-piperaziny Pramipexole Base SAM001247006 AB00053772_16 SND-919CL2Y BIDD:GT0250 SUD 919CL2Y CTK8C0068 UNII-83619PEU5T DS-14807 HMS2232B03 KBio2_007476 (6S)-4,5,6,7-tetrahydro-N6-propyl-2,6-benzothiazole-diamine MLS000758250 (S)-2-amino-6-propylamino-4,5,6,7-tetrahydrobenzthiazole;(S)-2-amino-6-propylamino-4,5,6,7-tetrahydrobenzthiazole Pramipexol 2,6-Benzothiazolediamine, 4,5,6,7-tetrahydro-N(sup 6)-propyl-, (S)- Pramipexole [USAN:INN] Sifrol AJ-45593 Spectrum_001838 CHEBI:8356 SW197453-4 D0G8NN DSSTox_RID_77054 FASDKYOPVNHBLU-ZETCQYMHSA-N J-001211 LS-40722 (6S)-N(6)-propyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2,6-diamine NC00073 (S)-N6-Propyl-4,5,6,7-tetrahydrobenzo[d]thiazole-2,6-diamine Pramipexole (Mirapex) 2-amino-4,5,6,7-tetrahydro-6-propylaminobenzothiazole RT-015572 AB00053772-13 SND 919 B1488 SR-01000763219-6 CPD000449298 Tox21_112445_1 DB00413 HMS2051A21 KBio2_002340 (-) Pramipexole Mirapexin (S)-2-Amino-4,5,6,7-tetrahydro-6-(propylamino)benzothiazole NCGC00167441-03 104632-26-0 Pramipexole Teva 632P260 SC-46343 AB0055235 SpecPlus_000820 CAS-104632-26-0 SUD-919CL2Y CX1349 ZINC3781664 DSSTox_CID_3496 HSDB 8253 KBioSS_002343 (6S)-6-N-propyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2,6-diamine MLS001423952 (S)-N 6-propyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2,6-diamine Pramipexol [Spanish] 2,6-Benzothiazolediamine, 4,5,6,7-tetrahydro-N6-propyl-, (6S)- Pramipexolum A801025 Sifrol(TN) AK-55454 SR-01000763219 SY009549 DB-038042 DTXSID6023496 [ Show all ]
Inchi Key	FASDKYOPVNHBLU-ZETCQYMHSA-N
Inchi ID	InChI=1S/C10H17N3S/c1-2-5-12-7-3-4-8-9(6-7)14-10(11)13-8/h7,12H,2-6H2,1H3,(H2,11,13)/t7-/m0/s1
PubChem CID	119570
ChEMBL	CHEMBL301265
IUPHAR	953
BindingDB	50116766
DrugBank	DB00413
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
	N/A	N/A	DrugBank
Activity	<75.0 %	None	ChEMBL
Activity	95.0 %	PMID23237836	ChEMBL
EC50	5.0 nM	PMID18313303	BindingDB,ChEMBL
EC50	7.079 nM	None	ChEMBL
EC50	27.0 nM	PMID17976986	ChEMBL
IC50	<10000.0 nM	PMID23237836	BindingDB,ChEMBL
Intrinsic activity	100.0 %	PMID18313303	ChEMBL
Ki	21.0 nM	PMID15801839, PMID16134944	BindingDB,ChEMBL
Ki	27.0 nM	PMID12161137	BindingDB,ChEMBL
Ki	39.8107 - 7943.28 nM	PMID7756621, PMID7664822	IUPHAR
Ki	40.0 nM	PMID12161137	BindingDB,ChEMBL
Ki	139.0 nM	PMID11000009	ChEMBL
Ki	1900.0 nM	PMID15801839, PMID16134944	BindingDB,ChEMBL
Ki	6300.0 nM	PMID15801839, PMID16134944	BindingDB,ChEMBL

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218