Hello, can I please just double check something. I was reading this point here: https://zhanglab.ccmb.med.umich.edu/bbs/?q=node/2937#comment-form
1. My sequence is:
GLSKGFGLKLDRISMSGLGCVQQRKESKKPPAKLQPR
2. I have run this sequence through PSSPred, both the command line version and on your server, listed here. https://zhanglab.ccmb.med.umich.edu/PSSpred/
3. I have attached the two outputs (command_line_answer and server_answer).
4. As you can see, they are not the same.
5. My questions are:
(a) Is this an issue
(b) Which one is more reliable as the true structure?
Thanks